SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017261 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017261
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000367
Family Putative glucosidase YicI, domain 3 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017261   Gene: ENSTGUG00000016978   Transcript: ENSTGUT00000017645
Sequence length 34
Comment pep:novel chromosome:taeGut3.2.4:Un:83520384:83522964:-1 gene:ENSTGUG00000016978 transcript:ENSTGUT00000017645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIDTAFLWGPAFMIAPVLEEATRSVSIYFPEAQW
Download sequence
Identical sequences H1A2Z9
ENSTGUP00000017261 59729.ENSTGUP00000017261 ENSTGUP00000017261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]