SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017267 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017267
Domain Number 1 Region: 9-93
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.95e-23
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.00034
Further Details:      
 
Domain Number 2 Region: 86-160
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-16
Family beta-glycanases 0.000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017267   Gene: ENSTGUG00000016984   Transcript: ENSTGUT00000017653
Sequence length 165
Comment pep:novel chromosome:taeGut3.2.4:Un:54144957:54145650:-1 gene:ENSTGUG00000016984 transcript:ENSTGUT00000017653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSSAAGGRPCDAKDFGHGSLVCACSATYCDTLDPLVLPAPGSYVKYESSKAGKRLERSE
GKFQHNAESPDFHLTLDTAQRYQKVKGFGGSITDAAAINIQSLSKDAQKHLLRSYFSEEG
IEYNLVRVPMASTDFSVRLYTYADAEGDFELRHFNLTEEDTHMKV
Download sequence
Identical sequences H1A305
ENSTGUP00000017267 ENSTGUP00000017267 59729.ENSTGUP00000017267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]