SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017284 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017284
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily Cupredoxins 4.64e-48
Family Multidomain cupredoxins 0.0000184
Further Details:      
 
Domain Number 2 Region: 160-319
Classification Level Classification E-value
Superfamily Cupredoxins 3.56e-27
Family Multidomain cupredoxins 0.0000516
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017284   Gene: ENSTGUG00000016997   Transcript: ENSTGUT00000017671
Sequence length 321
Comment pep:novel chromosome:taeGut3.2.4:Un:25291949:25295351:1 gene:ENSTGUG00000016997 transcript:ENSTGUT00000017671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGIDKEFYLLFNVFDENLSWYLNANIKYYLRMEETSVKKDDDFEESNRMHAINGLMFGNL
PGLDVCEGDKVSWHLLGLGSETDVHRAVFQGNTMQMNGMRRDSASLFPHTFATAFMQPDN
SGTFEIYCQTSNHYQSGMRQQYKVSKCGRTGTASAHRYRGVRTFYVAAEELLWDYAPDRS
WERQRHNHSAERDVCIGFTFLSYRNGTGVLKLQNWDCLLLTSATLETSREPWDMEEHFAL
TSPFLWAEVGDILNIVFKNNASRPYSIHAHGVLEQQTGHPQVANPGDIVTYRWEVPERSG
PGPNDSACVPWIYYSAVDPVK
Download sequence
Identical sequences H1A322
ENSTGUP00000017284 ENSTGUP00000017284 59729.ENSTGUP00000017284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]