SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017287 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017287
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-57
Family Eukaryotic proteases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017287   Gene: ENSTGUG00000017003   Transcript: ENSTGUT00000017674
Sequence length 196
Comment pep:novel chromosome:taeGut3.2.4:Un:54443656:54445770:1 gene:ENSTGUG00000017003 transcript:ENSTGUT00000017674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFGVDVRRYLLRVGDYHTGVKDEFERELPVERIVLHRNYWAGSNDNDIALVRMRGREGHC
LSFNHHVLPICLPDRRERSDINRQACIISGWGDTGKSYSRTLLQGVVPLLPREDCEARYG
QKFTNRMICAGNLSEDKRVDSCQGDSGGPLMCQRSNGRWIILGITSWGYGCGRKDSPGVY
TKVSKFVPWIKKVTKL
Download sequence
Identical sequences H1A325
59729.ENSTGUP00000017287 ENSTGUP00000017287 ENSTGUP00000017287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]