SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017310 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017310
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-20
Family BM-002-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017310   Gene: ENSTGUG00000017024   Transcript: ENSTGUT00000017699
Sequence length 48
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:140742240:140744908:-1 gene:ENSTGUG00000017024 transcript:ENSTGUT00000017699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFRLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAG
Download sequence
Identical sequences A0A091EHC3 H1A348
ENSTGUP00000017310 59729.ENSTGUP00000017310 ENSTGUP00000017310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]