SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017342 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017342
Domain Number 1 Region: 146-235
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000448
Family UBX domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017342   Gene: ENSTGUG00000017062   Transcript: ENSTGUT00000017731
Sequence length 235
Comment pep:known_by_projection chromosome:taeGut3.2.4:21_random:753372:754094:1 gene:ENSTGUG00000017062 transcript:ENSTGUT00000017731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TITMHVSRPKSAKGQRPSLSHRQGTEACPCHEPSSPPAASPRELATSWRAPLSRAAFPPA
QVSPEEIPKLLQQVPLKSSSSLNKYRVLPSIGQKGAGGSAVEALAERTDRLEVSEGQEDA
PKTIQTFSEGREFASTLSGRGIPTEESSHMHCAPEQQESLEEPQVLLAVRSPSGRRFEHH
FRPSDSLQKVLAVAGQKLLADYQHCRIETMEVPRRSFSDLTKSLQECGILPKSVL
Download sequence
Identical sequences H1A380
ENSTGUP00000017342 ENSTGUP00000017342 59729.ENSTGUP00000017342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]