SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017365 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017365
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.92e-22
Family YVTN repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017365   Gene: ENSTGUG00000017079   Transcript: ENSTGUT00000017754
Sequence length 165
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:169773932:169775521:1 gene:ENSTGUG00000017079 transcript:ENSTGUT00000017754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAAMAWKPLCASILARGLPEVLVWHLDPTSLSTRPSSGCAQVLSYPGHGPVTSLAWAPS
GERLLSASPVDTAMLVWDVSTETCVQLQWFGGGGVTYVAWSPDGSKVLAATPSAVFRVWE
AQMWTCERWPTIRGRCQTGCWSPDGSRLLFTVLGESVIYSLSFSE
Download sequence
Identical sequences H1A3A3
ENSTGUP00000017365 ENSTGUP00000017365 59729.ENSTGUP00000017365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]