SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017391 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017391
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-18
Family Ubiquitin-related 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017391   Gene: ENSTGUG00000017107   Transcript: ENSTGUT00000017781
Sequence length 150
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:55763027:55763939:1 gene:ENSTGUG00000017107 transcript:ENSTGUT00000017781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAEPTLVLRLKFLNDTERLARVRPGDTVGALKRTYFPGQEQQVRLIYQGQLLRDDAQSLA
GLHLGHLSVLHCHLSPPSAAPTAPGTPGPRSPAPAALGVGSLALPLFVLLLALLWYLQLQ
HRHVFTATATTCLAGLTLLVTFVAFAMYRR
Download sequence
Identical sequences H1A3C9
ENSTGUP00000017391 ENSTGUP00000017391 59729.ENSTGUP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]