SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017430 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017430
Domain Number 1 Region: 86-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000191
Family Thioltransferase 0.055
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000393
Family Chaperone J-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017430   Gene: ENSTGUG00000017133   Transcript: ENSTGUT00000017826
Sequence length 722
Comment pep:known_by_projection chromosome:taeGut3.2.4:21_random:858562:866052:-1 gene:ENSTGUG00000017133 transcript:ENSTGUT00000017826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPDKNKDPGAEDKFIQISKAYEILSNEEKRANFDRYGDAGESQGFSQQQHRQFHRFHDGF
YFDESFFHFPFNSERRDTSDEKYLLHFSHYINEIVPDSFKKPYLIKITSDWCFSCIHIEP
VWKEVAQELEALGAGIGVVHAGYERRLAHHLGAHSTPTLLGLINGKITFFHNAVVRENLR
QFVENLLPGNLVEKITDKNYIRFLSHWRKDNKPHVLLFDHMPVVPLLYKLTAFAYRDYLS
FGYVYVGLRGTEELSSQYNINVYTPTMMIFKEHIDRPADVVQAREMKKQLIDDFLSQNKF
LMVARLTSQGMFQELCPVKKSHRQRKHCVVLFTEEGEKFAEAYEAFLTFAVANTKDTLRF
VHVYSDRQPEFADALLMDEEKYHGRSAVVILERRNNAGKIAYKALEEAWQGSKEDNFILL
DLLDQLRTDPGLLSSETVVADLNDELAPMFLIRWFYSTVDYISDWWDSLFHSNWREMMPL
LSLLFSALFILFGTVIVQAFSDSSDTRDAPPSGKEETAAKTEKNDGSFSKESNSRIPKKS
FVEVTELTDINYTSNLVRLRPGHMNVVLILSNSTKTPLLQKFALEVYMFTGSSSLHFSFL
SLDKHREWLEYLLEFAQDAAPIPNQYDKHFLERDYTGYVLALNGHKKYFCLFKPHRSGDE
GGTPGLCEDYDALQHAEARGKSSCSPGSRSIKNKLHKLSFWMERLLEGSLQRFYIPSWPA
LD
Download sequence
Identical sequences H1A3G8
59729.ENSTGUP00000017430 ENSTGUP00000017430 ENSTGUP00000017430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]