SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017513 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017513
Domain Number 1 Region: 592-894
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.53e-77
Family Protein kinases, catalytic subunit 0.000000000236
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-73
Family Ephrin receptor ligand binding domain 0.0000000166
Further Details:      
 
Domain Number 3 Region: 302-507
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-42
Family Fibronectin type III 0.000026
Further Details:      
 
Domain Number 4 Region: 889-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.49e-21
Family SAM (sterile alpha motif) domain 0.0000446
Further Details:      
 
Domain Number 5 Region: 231-302,340-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000628
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017513   Gene: ENSTGUG00000017194   Transcript: ENSTGUT00000017912
Sequence length 965
Comment pep:known_by_projection chromosome:taeGut3.2.4:21_random:1103706:1196999:-1 gene:ENSTGUG00000017194 transcript:ENSTGUT00000017912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLMDSTTATAELGWTVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKYIRR
RGAHRIHMKFSVRDCSSIPNVPGSCKETFNLYYFESDFDSATKTFPNWMENPWMKVDTIA
ADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRVIQ
NGAVFQETLSGAESTSLVAARGTCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCRAGYES
VENGTVCRGCPSGTFKASQGDEGCVHCPINSRTTSEGATNCVCRNGYYRADADPVDMPCT
TIPSAPQAVISSVNETSLMLEWSPPRDSGGREDLVYNIICKSCGAGRGACTRCGDNVQFA
PRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIM
HQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKDLSELNSTTVKSPTNTVAVQNLKAGT
IYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSVQEKLPLIVGSSAAGLVFLIAVVVIG
IVCSRRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCV
KIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPN
VIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMN
YVHRDLAARNILVNSNLVCKVEHFSASQHCSCSLCYHAVFVLQGGKIPIRWTAPEAIQYR
KFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPNALHQLMLD
CWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGMNLPLLDRTIPDYTSFNTVDEW
LDAIKMSQYKESFASAGFTTFDVVSQMTVEDILRVGVTLAGHQKKILNSIQVMRAQMNQI
QSVEV
Download sequence
Identical sequences H1A3Q0
59729.ENSTGUP00000017513 ENSTGUP00000017513 ENSTGUP00000017513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]