SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017527 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017527
Domain Number 1 Region: 581-859
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-81
Family Protein kinases, catalytic subunit 0.00000000141
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-71
Family Ephrin receptor ligand binding domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 297-501
Classification Level Classification E-value
Superfamily Fibronectin type III 5.6e-43
Family Fibronectin type III 0.00000959
Further Details:      
 
Domain Number 4 Region: 877-943
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.92e-20
Family SAM (sterile alpha motif) domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017527
Domain Number - Region: 226-294,345-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00227
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017527   Gene: ENSTGUG00000017239   Transcript: ENSTGUT00000017927
Sequence length 944
Comment pep:known_by_projection chromosome:taeGut3.2.4:21_random:1319792:1358235:-1 gene:ENSTGUG00000017239 transcript:ENSTGUT00000017927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNLLDTSTILGDWGWMTYPSHGWDSINEMDEFFSPIHTYQVCNVMTPNQNNWLRTNWVQR
DGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYMESDRDLGSSTRESQFLKIDTIAAD
ESFTNVDLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACIAIVSVRVYYKKCPATVRNL
ASFSEAVTGADSSSLVEVRGECVGHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEEQRD
SCTACQLGFYKSAPGDQLCAKCPLHSHSESRAARVCHCDSSFYRAVQDPPSAACTRPPSA
PVNLISSVNGTSVTLEWGPPLDKGGRADIVYNVLCRRCAGDAGPCEACGSGIRFVPQQMS
LVQGALTVTNLLAHTNYSFWVEAVNGVSDLSLESRRAAVANITTNQAAPSQVVVVHQEST
GQNSVTLLWQEPDQPNGIILEYEIKYYEKDKEMQSYSTLKSKSTTATISGLKPATRYIFQ
VRARTSAGCGRFSQTVEVETGKPVSLRYDTMTIVWICLTLITGLVTLLVVLICKKRLCAL
HCGYSKAFQDSDEEKMHYQNGQGFYVDPHTYEDPCQAVHELTREIEASRIKIEKVIGSGE
SGEVCYGRLKLPGKREIPVAIKALKAGYTEKQRRDFLSEASIMAQFDHPNVIHLEGVVTR
SKLVMIVTEYMENGSLDTFLRKHDGQFTIIQLVGMLRGIGAGMRYLSDLGYVHRDLAARN
ILVNSNLVCKVSDFGLSRILEDDPDAAYTTTGGKIPIRWTAPEAIAYRKFSSASDVWSYG
IVMWEVLAYGERPYWNMTNRDVINSVEEGYRLPAPMGCPTTLHQLMLDCWQKERSERPRF
AHIVGVLDKLIRNPDNLKCTGTLNRFTQTRLDRGLLDLTSCLTVEDWLDSIRLGHYRDNF
AMAGYSSLGMVMRMNIEDVRSLGITMMGHQKKILSSIQAMRSQL
Download sequence
Identical sequences H1A3R4
59729.ENSTGUP00000017527 ENSTGUP00000017527 ENSTGUP00000017527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]