SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017537 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017537
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-54
Family Glutathione peroxidase-like 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017537   Gene: ENSTGUG00000017259   Transcript: ENSTGUT00000017938
Sequence length 224
Comment pep:novel chromosome:taeGut3.2.4:8_random:1230351:1238039:-1 gene:ENSTGUG00000017259 transcript:ENSTGUT00000017938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVMPGLLLGDEAPDFEADTTQGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAQLAP
EFSKRNVKMIALSIDSVQDHLSWCKVRLWGGLGAACRLGGTSVTSQSGAVLKFRVGMGKV
FSVFVEHPTKSRVVFIFGPDKKLKLSILYPATTGRNFDEILRVLDSLQLTAYKKVATPVD
WKPGDSVMMVPTLPDEEAKKLFPKGVFTKELPSGKKYLRYTPQP
Download sequence
Identical sequences H1A3S4
59729.ENSTGUP00000017537 ENSTGUP00000017537 ENSTGUP00000017537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]