SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017542 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017542
Domain Number 1 Region: 245-323
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000128
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017542
Domain Number - Region: 829-885
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0144
Family C-terminal domain of PLC-beta 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017542   Gene: ENSTGUG00000017265   Transcript: ENSTGUT00000017943
Sequence length 1148
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:1457242:1479266:-1 gene:ENSTGUG00000017265 transcript:ENSTGUT00000017943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETSETSQPEAVSPPSADVNEASSSIVPSTENTSSSPTSEIPPVSQPDAIENSRADIPVVS
SSEAEQSEPDCDIGGTLEADPQSEPSSFVSPPESLAGQHIENISSSHGKGKKTKSEFESK
VSAAEKGADEQKSALNASENLKREKDFKKTGEIDPTSVITPKDPGDIPTFDEWKKKVMEV
EKEKSQSMHPSAVGGQHSTKKVQKNRNNYASVECGAKILAANPEAKSTSAILMENMDLYM
LNPCSTKIWFVVELCEPVQVKQFDIANHELFSSTPKDFLVSISDRYPTNKWIKLGTFHAR
DERNVQSFPLDEQMYAKYVKMFIKYIKVELISHFGSDIFSKVKLKRRVFGTSMVEEYEEI
ADSQYQSDFMSCSSLYIDYLLDYNTGEEKSSKNLLGSATNAILSMVNIAANMLGAKTEES
PETEAGNKSVSENVTATPATSTAAPRLPEPTPVPSPELVTTDIPQIEKEQLKVDLTKESP
IVQLVQEYEEDTSQSTVTLLSSDEQEEEAAAWFELETEKYCCDMAAVCCISTFSEYLLKW
CSVAAAMHRQHSKTGGEERPPHPPQPALTESAQTAAEEPLPEQLDSKAEKPPGSAVAVDF
SAVHEEVSNETTESIELEPSHPQTVSQSLLLEVTSEAKPAPTTDMVLEPPKEDSGQVAPR
VTLQVDVPELSTDMEKAESSVVEESPEPSVATEVKEMSTRETFATPVIPKPTETVVQPES
TVDMVASDAVEGKESSAEVQKPAVPPVELPVPAETKEEEQAAEEALLALPVSGPQRTATD
FYAELQNSTELGYANGNLVHGSNQKESVFMRLNNRIKALEVNMSLSSRYLEELSQRYRKQ
MEEMQKAFNKTIIKLQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQLASNLSATVAELKRE
VSDRQTYLVISLVLCLILGLVLFVQRCRSPSQFCEDYLSKIPKSNHYPSPKRCFSSYDDM
NLKRRTSLPLVRSQSFQLAGKEVDPDDLYIVEPKFSPEKKKKRCKYKSEKPETIKPTTEP
LHPIANGEIKGRKPFTNQRDFSNIGEVYHSSYKGPPSEGSSETSSQSDESYFCGISACTS
LCNGQTQKTKTEKRAVKRRRSKVSDQGKLIKTLIQTKSGSMPSLHDIIKGNKDITVGTLG
VTTVSGHI
Download sequence
Identical sequences H1A3S9
ENSTGUP00000017542 ENSTGUP00000017542 59729.ENSTGUP00000017542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]