SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017566 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000017566
Domain Number - Region: 122-238
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0157
Family YVTN repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017566   Gene: ENSTGUG00000017289   Transcript: ENSTGUT00000017968
Sequence length 300
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:1724318:1725462:1 gene:ENSTGUG00000017289 transcript:ENSTGUT00000017968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWEPHPLSYRELQSERTEVPVSRLLEETALGRPGKEDSAGCGQLVWVGEPVVLGRADSIA
GKYGVWMKDPEPVPPFTRDNTWRVDTVGTEVRQLFQYEEAEQLARGYPAKVHILPRPLES
TGAVIYRGGLFFQPRQSRSVARYDLRGETITAEREIPGAGYHGQYPYSWGGYTDIDLAVD
EAGLWVIYSTEKARGAIVLSKLDPETLEIRRTWETIRKRGVANSFLICGTLYTVSSYSAP
NAAINFAYDTATGTSRGLGIPFENRFRYVSMMGVQPCRAGSSSAWDSFNMVTYPVRLSRA
Download sequence
Identical sequences H1A3V2
ENSTGUP00000017566 ENSTGUP00000017566 59729.ENSTGUP00000017566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]