SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017635 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017635
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.24e-39
Family Eukaryotic proteases 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017635   Gene: ENSTGUG00000017357   Transcript: ENSTGUT00000018037
Sequence length 99
Comment pep:novel chromosome:taeGut3.2.4:24_random:139865:140606:-1 gene:ENSTGUG00000017357 transcript:ENSTGUT00000018037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSPKLREAEVKLIDYKICNSDKVYEGYLTPRMMCAGYLQGGKDACQGDSGGPLVCEDDGR
WYVAGVTSWGTGCGQKNKPGVYTRVTKLLSWIYSKMEVR
Download sequence
Identical sequences H1A420
ENSTGUP00000017635 59729.ENSTGUP00000017635 ENSTGUP00000017635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]