SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017687 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017687
Domain Number 1 Region: 338-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000186
Family Growth factor receptor domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017687   Gene: ENSTGUG00000017409   Transcript: ENSTGUT00000018090
Sequence length 689
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:4373757:4377241:-1 gene:ENSTGUG00000017409 transcript:ENSTGUT00000018090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HREFARWKVNNLALERKDFFSLPLPLAPEFIRNIRLLGRRPSPQQITESLIKKYGTHFLL
AATLGGEESLTIFVDKRKLSRRAEPAAGAGNSSGVSLETLHQLAASYFIDRESTLRRLHH
IQIATAAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKVQLQGLQTVLPSYLRERFVA
AALSYIACGSAGELLCRRSDCRCQCQPALPRCNCPEADVQALESSLAQLGRAWESHHSQF
EESEEFQALVKRLPTDRFLNRTAISHFWTMDLDVQHRYQQLGTSLKLLSRKTYRLIRRLF
NLSKRCHRQPRFKLPKERSLPYWWSRAQSLLYCSETTVPGTFLEESHSCTCPSEQPSCQG
SIPCALGEGPACASCDQDNSTRCGTCNHGYVLAQGSCRPEVADSLEHYLGLETDLQDLEL
KYLLQKRDSRIEVHSIFISNDMRLGSWFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQI
CLTKNSTLEPVMAIYVNPFGGSHSESWFMPVNEGSFPDWERTTVDASAQCQNWTITLGNK
WKTFFETVHVYLRSRIKSLDDSSNETIYYEPLEMSDPSKNLGYMKINSLQVFGYSLPFEP
DAIRDLILQLDYPYTQGSQDSAMLQLLEIRDRVNRLSPPGKIRLDLFTCLLRHRLKLANN
EVARIQSSLRAFSARLPNALEQETGKLCS
Download sequence
Identical sequences H1A472
59729.ENSTGUP00000017687 ENSTGUP00000017687 ENSTGUP00000017687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]