SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017694 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017694
Domain Number 1 Region: 31-104,137-155
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000104
Family Reprolysin-like 0.059
Further Details:      
 
Domain Number 2 Region: 862-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 927-985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000139
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number 4 Region: 819-867
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017694
Domain Number - Region: 734-805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00487
Family Complement control module/SCR domain 0.0076
Further Details:      
 
Domain Number - Region: 409-447
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0204
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017694   Gene: ENSTGUG00000017415   Transcript: ENSTGUT00000018097
Sequence length 1128
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:4458360:4524385:-1 gene:ENSTGUG00000017415 transcript:ENSTGUT00000018097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCRAYMSVKELKEALQLNSTHFLNVYFASSVREELAGAATWPWDKEALSHLGGVVLNPAY
YGMHGHTNTMIHEVGHVLGLYHVFKGVSERESCDDPCRETTPSMETGDLCADTAPTPKSK
LCRDPDPTNDTCGQTHFTGTPFNNYMSYTDDDCTNSFTPNQVARMHCYLDLVYQRWGHSK
KPAPIPIPAMVTGQTQHSLSIYWLPPISGVIHEREQDTLCDSCAEDGTFRQYVHEASSPR
VCDSSGYWTPEEAEGPPDVDQPCEPSLQAWSPELHLYDMNMTVPCPQPDGCILELRFLHP
VYPDSLTLWTTYLSTGSPKALSDIEILTEQGESIHLGPLDTFCDVPFTVKLNIPKKMSGV
KIYTFDERMEIDTALLTSRPHSSLCSACRLIQYRVLRDPPFADGSPATPLQAHRQFIDTE
VTPGQLYRYQVQVVSGTTSGEASPPLVHVHGAPYCGDGKVTTSLEEECDDGDLLDGDGCS
RKCKKEKGFNCVGEPSLCYVHDGDGVCEPFEETSSMLDCGPHTPEGYVDLWAVKAYASQQ
DEKSCLASIVTGEPVVKVCKSHLHEVPKDLLQAAWFPCAPSQGNAQGPNEKMLLGDEGVW
LKICQEILTVTPSLLLYLASSGTVPSQQLKPAVAVQLTDTDGQNHSLGTYELSCQHNPLT
INVTHSQEDPFPQVTSVLLNFSSPLVGIAAVALRTLAQPGSSDPLTSCLLQHQQGCGHPC
HSCAHGACVGLGVCTQPLLAHTATLNCSSDGPRHMTCAVSCEKGFVLHSSGGKRLGSWQQ
EVVLRCRSGQWDRSVTCDPVDCHVPDQSHVSYAEFSCPVGTTYLQRCSFSCIPPAKLQGT
NQWLSCLEDGLWSLPEAYCKLECAAPPAVPNARLLVPRCLQGSHDVGSVCRYKCKPGYHV
AENTADKPKKKFLKVQCLESGQWEEGHCVPVVCKPPPPVFEGMYNCTQGFELDSQCVLNC
EQQGQQVPIVCTKEGLWTEDFKLCENLQGTCPPPPELNFVEYKCEQGHGIGAVCIPSCVI
PPSDPVILPKNVTAETMDHRLQPTRVQNIVCTGRLRWYPDPSVIHCIQSCEPFQADGWCD
TINNRAYCQYDGGDCCSSTLSSRKVIPFAADCDQDECTCRDPAAEENQ
Download sequence
Identical sequences H1A478
ENSTGUP00000017694 59729.ENSTGUP00000017694 ENSTGUP00000017694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]