SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017705 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017705
Domain Number 1 Region: 1124-1346
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.96e-84
Family Fibrinogen C-terminal domain-like 0.00000104
Further Details:      
 
Domain Number 2 Region: 953-1115
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-23
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 686-849
Classification Level Classification E-value
Superfamily Fibronectin type III 2.13e-21
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 4 Region: 326-500
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-20
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 861-950
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-17
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 6 Region: 506-675
Classification Level Classification E-value
Superfamily Fibronectin type III 2.56e-16
Family Fibronectin type III 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017705
Domain Number - Region: 238-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 269-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 207-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0229
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 299-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017705   Gene: ENSTGUG00000017420   Transcript: ENSTGUT00000018108
Sequence length 1357
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:4774719:4806307:1 gene:ENSTGUG00000017420 transcript:ENSTGUT00000018108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVDGENPVLRSVVISFSLLLLGAVLKPFECRLEMTAEPAERTAVDEAGGLANCSPPIKE
QPMVFHHIYNINIPLDSCCSSMFKSSAEEVSSEDERLAEYTEQTSDSESQVTFTHRINMP
KQACKCSTSLPSLQELLSRIEMLEREVSILRDQCTSNCCQENAATGQLDYIPQCSGHGNF
SLESCSCVCMEGWAGSNCSEPRCPGGCSSRGVCLEGQCICDSDYGGEDCSQLRCPAGCGS
RGLCVDGECVCEEGFTGEDCSQLRCPRDCSGRGRCVNGTCECPEGFGGEDCARPRCPGAC
GGRGLCRDGLCVCQPGYGGQDCSAVSPPENLRVTGISDSSIELAWDGSGAATEYVVSYQP
AVPGGTQLQQRVPGDWSSITITDLEPGVAYNVSIYAVISDVFSIPVTSKVMTNLATPQGL
KFKTITETTAEVQWEPFSFPFDGWEISFIPKNNEGGVIAQLPSTVTTFNQTGLKPGEEYT
VTVVALKEQARSPPTSDSVSTLIDGPTQILVRDVSDTVAFVEWTPPRAKVDAILLKYGLA
DGEGGRTTFRLQPPLSQYSLQALRPGARYHLAVSALRGANESRPAFAQFTTEIDAPKNLR
VGSRSPASLELAWDNSEAEAHSYRVVYSTLAGEHYHEVLVPRDTGPTTRATLADLVPGTE
YGIGISAVMDSQQSVPATMNARTELDSPRDLLVTASTETSISLAWTKATGPIDHYRITFT
PASGMASEVTVSRDESQLTLSELEPGTEYTISIIAERGRQQSLEATVDAFTGVRPISQLH
FSQLTSSSVNVTWSDPSPPADRLILTYSPRDEEEEAQQVTLDGTRRHTSLMGLQPSTEYL
VSLVAVHGTISSEPVVGSITTGIDAPKDLRVDNVTQESMMVYWSAPIAAFDHYRMSYRPG
QQRRTESMAISRDATEYTLQDLQPATKYEIGVKSVRGREESELASITAYTAMDVPLGVTA
TNITPTEALLQWNPPLSEVESYVLILTRRAVAGETILVDGDSQEYQLTNLLPSTTYTVSM
YATSGPLTSQTISTNFTTLLDPPTNLTASEVTRRSALLSWVPPVGEIENYVMTYRSTDGS
RKELIVDAEDTWIRLEGLSETTEYTVHLQAAQNAMRSGLISTTFTTGGRVFANPQDCAQH
LMNGDTLSGVYTISINGDLSQRVPVYCDMTTDGGGWIVFQRRQNGLTDFFRKWADYRVGF
GNLEDEFWLGLDNIHKITSQGRYELRIDMRDGQEAAYAYYDKFSIGDSRSLYKLRIGDYN
GTSGDSLTYHQGRPFSTKDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQGI
NWYHWKGHEFSIPFVEMKMRPYNHRNISGRKRRSLQL
Download sequence
Identical sequences H1A489
ENSTGUP00000017705 59729.ENSTGUP00000017705 ENSTGUP00000017705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]