SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017726 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017726
Domain Number 1 Region: 28-240
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-55
Family DBL homology domain (DH-domain) 0.0000000888
Further Details:      
 
Domain Number 2 Region: 231-280
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000892
Family Pleckstrin-homology domain (PH domain) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017726   Gene: ENSTGUG00000017444   Transcript: ENSTGUT00000018129
Sequence length 280
Comment pep:novel chromosome:taeGut3.2.4:9_random:46486:50401:-1 gene:ENSTGUG00000017444 transcript:ENSTGUT00000018129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVNQDEPMEDYPLKVEGGKEDDSRRFGMGQTTKDQMRTNVINEIISTERDYIKHLKDIC
EGYIKQCRKRADMFTEEQLKTIFGNIEDIYRCQKKFVKALEKKFNKDHPHLSEVGSCFLE
YQTEFQIYSEYCNNHPNACLELSRLTKVNKYVYFFEACRLLQKMIDISLDGFLLTPVQKI
CKYPLQLAELLKYTNPQHRISRMWRLSLNAMKNMARLINERKRRLENIDKAQWQSSIEDW
EGEDVLVRSSELIYSGELAKISHPQAKSQQRMFFLFDHSL
Download sequence
Identical sequences H1A4B0
ENSTGUP00000017726 ENSTGUP00000017726 59729.ENSTGUP00000017726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]