SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017736 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017736
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.12e-25
Family Chitinase insertion domain 0.0000633
Further Details:      
 
Domain Number 2 Region: 1-24,94-145
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-22
Family Type II chitinase 0.00056
Further Details:      
 
Domain Number 3 Region: 188-235
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000256
Family Tachycitin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017736   Gene: ENSTGUG00000017454   Transcript: ENSTGUT00000018139
Sequence length 235
Comment pep:known_by_projection chromosome:taeGut3.2.4:26_random:158005:159418:1 gene:ENSTGUG00000017454 transcript:ENSTGUT00000018139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYAMNYWKSNGAPAEKLLVGFPTYGKSFTLQSPSDTSVGAPASGPGPAGPYTREAGTLAY
HEICTFLNSGATQAWHAPQDVPYAYKGSEWVGYDNVRSFGLKVDWLKKNNFGGAMVWALD
MDDFTGDFCKEGKYPLISSLKKGLGLQSGDCVPPAEPQPPTSGGSSGSGGSGGSGGSGGS
GGSGGSGFCAGKPNGIYADPSNGRNFYNCLNGQTFVQSCQPGLVFDPVCSCCNWP
Download sequence
Identical sequences H1A4C0
59729.ENSTGUP00000017736 ENSTGUP00000017736 ENSTGUP00000017736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]