SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017737 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017737
Domain Number 1 Region: 84-363
Classification Level Classification E-value
Superfamily L domain-like 3.63e-45
Family Ngr ectodomain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017737   Gene: ENSTGUG00000017456   Transcript: ENSTGUT00000018140
Sequence length 382
Comment pep:known_by_projection chromosome:taeGut3.2.4:26_random:181656:185093:-1 gene:ENSTGUG00000017456 transcript:ENSTGUT00000018140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWATTIILILAGLCGSSLGQYNEEEDLAWLQYYLRQSRVSSYNYVPYYEEESPAYAYSY
PSATDTEPEPEPEPQQAAPWRCPQECDCPPNFSSAMYCDTRNLRYLPFVPSRMKYVYFQN
NLITSVQEGAFDNATELEWLALHNNQIGSEKMGKRVFGKLQRLERLYMNNNNLTRLPGPL
PRSLRELHLSYNHISKVPSNALEGLENLTALYLSHNFIFEMGASLKGLKSLILADLSYNN
LRKVPDGLPASLEQLYLEYNYINAIPDDYFQVSPRLLYVRMSHNSLTNQGLSSNTFNSSS
ILELDLSYNRLQKIPRVNTNLENLYLQGNQINEFSISSFCSVVDVMNYSRLQVLRLDGNA
IKRNAVPPDAPLCLRRATVIEI
Download sequence
Identical sequences H1A4C1
XP_002187769.1.42559 ENSTGUP00000017737 59729.ENSTGUP00000017737 ENSTGUP00000017737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]