SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017763 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017763
Domain Number 1 Region: 16-355
Classification Level Classification E-value
Superfamily L domain-like 8.28e-63
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 2 Region: 399-486
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000254
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017763
Domain Number - Region: 498-564
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000128
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017763   Gene: ENSTGUG00000017481   Transcript: ENSTGUT00000018167
Sequence length 583
Comment pep:known_by_projection chromosome:taeGut3.2.4:26_random:472415:474163:-1 gene:ENSTGUG00000017481 transcript:ENSTGUT00000018167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPRCVCQIRPWYTPRSAYREAATVDCNDLFITSVPPELPEGTQTLLLQSNNIARLEQGE
LGYLRNLSELDLSQNSFSDVWDFGLRNMPQLLSLHLEENQLSELPDSSFPGLGNLQELYL
NHNRLRSIAPRAFAGLGSLLRLHLNSNLLRTLDSRWFQMLPSLEILMVGGNKVDAILDMN
FRPLGNLRSLVLAGMQLREISDYALEGLRSLESLSFYDNKLADVPKRALQQVPGLKFLDL
NKNPLQRVKQSDFTNMLHLKELGLNNMDELVSIDQFALINLPELTKLDVTNNPKLSFIHP
KAFQHLPQLETLMLNNNALSALHRQTVESLPNLQEISIHGNPLRCDCVIRWVNSTRPRVR
FIEPQSTLCAEPPDLQRRHIRDVPFREMTEQCLPLISARSIPPRLEAEVGDNVALHCRAL
AEPEPEIYWVTPTGAKLLPFGDDGKFKVHSEGTLEIRAIAAREAGLYTCVAHNLLGADTR
GVRVLVNRSFPLGQAELELLVVDVQPHHVLLAWRPCLNAVSSNLTWASSTLGSRLGAARI
PAGTHSFNITRLRPDTEYRACLHVSLVASPVRVACVTARTKEA
Download sequence
Identical sequences H1A4E7
ENSTGUP00000017763 ENSTGUP00000017763 59729.ENSTGUP00000017763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]