SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017801 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017801
Domain Number 1 Region: 10-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-46
Family Protein kinases, catalytic subunit 0.000000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017801   Gene: ENSTGUG00000017521   Transcript: ENSTGUT00000018206
Sequence length 275
Comment pep:novel chromosome:taeGut3.2.4:Z_random:682303:686234:-1 gene:ENSTGUG00000017521 transcript:ENSTGUT00000018206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSEGDPEAKYTELETIGRGGFGTVCMAVETATGEEVAIKKISLLEESNSEVCLNEIQI
MRCNKNANLVTFVDSYLVDEELWLVMEYMDGGSLHDVIRETHMAEGEIAAVSRECLQGQP
LDFLHSKQVIHRDIKANILLGLDGSVKLGGAGCPAASAEHSHQLQLLGSCSWAEGVRSAF
GLATGEWSLSIWRVKETGGAWHFLLLQVQQLISTRGTPKLQKPRQQSAWLRDFLCCCLET
DGDRRWSAQELLQHPFVTSAKPTSSLTPLIMATQQ
Download sequence
Identical sequences H1A4I5
ENSTGUP00000017801 ENSTGUP00000017801 59729.ENSTGUP00000017801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]