SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017821 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017821
Domain Number 1 Region: 55-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000543
Family APG12-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017821   Gene: ENSTGUG00000017541   Transcript: ENSTGUT00000018226
Sequence length 104
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z_random:2645598:2646065:1 gene:ENSTGUG00000017541 transcript:ENSTGUT00000018226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAEPGERPPPAAPHGGGRSDGAEEAQEGGAPAGPAEPGPPPAGSPGSEEPAGDARKKID
VLLKAVGDTPIMRTKKWAVERTRTIQGLVEFIKKFLKLMASEQL
Download sequence
Identical sequences H1A4K5
59729.ENSTGUP00000017821 ENSTGUP00000017821 ENSTGUP00000017821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]