SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017891 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017891
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000136
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017891   Gene: ENSTGUG00000018193   Transcript: ENSTGUT00000019272
Sequence length 108
Comment pep:novel chromosome:taeGut3.2.4:Z:7235958:7238276:1 gene:ENSTGUG00000018193 transcript:ENSTGUT00000019272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPDNSYFVWRKNGQKIKACITEQSHLLLDGRVHVLSWVKDSVSENTEYRCSFISKVGNVT
SEVLITVEDKDSSGQDAWTKEFDTWRNAISEHDKMMQTWRKTWETCNK
Download sequence
Identical sequences H1A4S5
59729.ENSTGUP00000017891 ENSTGUP00000017891 ENSTGUP00000017891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]