SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017893 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017893
Domain Number 1 Region: 224-335
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-31
Family Cadherin 0.00083
Further Details:      
 
Domain Number 2 Region: 428-552
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-29
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 115-222
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 328-432
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-25
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 544-648
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.0041
Further Details:      
 
Domain Number 6 Region: 18-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000143
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017893   Gene: ENSTGUG00000018535   Transcript: ENSTGUT00000018971
Sequence length 765
Comment pep:novel chromosome:taeGut3.2.4:13:16764683:16789163:1 gene:ENSTGUG00000018535 transcript:ENSTGUT00000018971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAALILVLCVSGLTAETARYSVPEEAGRGSFVANIAKDLGLTGEELLARQARVVPEGEK
QYLQLNQHTGDLVVREQMDREELCGQSEPCLVRFEVLLESPLQSFRAEVRLTDINDHAPV
FLNKEIVLKIPESAIPGTRFLLESAHDPDVGNNSLQHYSISSNEYFHVYTQRRSGGGRYA
ELVLDRALDREQQAEVAFIITAGDGGNPPRSGTALIRVIVLDTNDNIPVFTQSLYKVSVM
ENSSEDTIVVVVSASDLDAGTNGEIVYSIFQNSEENLQTFKINPETGQIHLKKPLDYEEK
KTYEIDVQATDGGGLSTHCKVEVQVVDVNDNAPELVVSSFSSPIPENTVPGTVVALFSVR
DRDSGANGKISCALEDQLSFSLRPAYKNYYELVTVSALDREETPQYILSVTAADAGSPPL
TSTQTFTVDISDVNDNAPVFNQTSYTMYVRENNVPTVFVGAVSAGDADVGLNAKVTYSLA
PEQGAERPSCSCISVNSENGHVFVLRPLDYEHLRQTEVTVSASDAGSPPLRANVTVRLVV
LDENDNAPLVLYPAQDGSPASSELVPVWAEAGYLIGKVVAVDADSGQNSWLSYHLLRATD
PGLFSVAVQSGEVRLRRPVTERDSVKQKLVVLVRDNGKPPLSATAALSALLLKDFSDVRL
PHSSPAPEDQDGSLTTYLIISLVFVSLLFLISSAVFVARKACRRKELEAGHVLYGADNLQ
SGLADAAAAGTLPRAYCYEISLTTGSGNSEFKFLRPILPSLPPQH
Download sequence
Identical sequences H1A4S7
ENSTGUP00000017893 59729.ENSTGUP00000017893 ENSTGUP00000017893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]