SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018031 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018031
Domain Number 1 Region: 128-180
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000236
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018031   Gene: ENSTGUG00000018226   Transcript: ENSTGUT00000018958
Sequence length 187
Comment pep:novel chromosome:taeGut3.2.4:4:22538729:22547838:1 gene:ENSTGUG00000018226 transcript:ENSTGUT00000018958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRPGGAVDSRPARKRSRLLPSSAGGTSQMEPIDLEETAGEVIDLTGVSSEPEVITISDD
ESPVVQDKGQSQQHSLGPSDTENSAELRASDSEEEPSDNDEYVTDEVSLQSGAAEEGAAL
SEPSASLLCVICMSCYSQIMQSGRLIVTTLCGHVFCSECLPVALEILGRCPTCRMDLTPD
LYHPIYI
Download sequence
Identical sequences H1A565
ENSTGUP00000018031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]