SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018068 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000018068
Domain Number - Region: 566-610
Classification Level Classification E-value
Superfamily UBA-like 0.00067
Family UBA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018068   Gene: ENSTGUG00000018197   Transcript: ENSTGUT00000019010
Sequence length 617
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:265965:267815:-1 gene:ENSTGUG00000018197 transcript:ENSTGUT00000019010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPASDGFQNPVQSSGLNSKICNPTNQLLDRSVSAPASICSSESSLAEPIDPRAVKTS
DSSPEHQITPEKEHALVLQHHSNSSSLANNDPSPHTGDGTCSNPACLSQKTLTETFSADI
LKECNAKGQDHGQEHPLEVTKVHLDDTATKHRQDKDVYLSSKQEQKHELPTDHQMCKEPE
KEHLEEQTETTDPEPPCCVDGVEKPAMAEAKQPENPPMEMRDGLERAGLSCVKGSIQLSA
SCSHVHVEASMEIDAEEQAAAEAQSSARQQKQQTENRHISNPNSEAFSMEVELLKSPSSL
SDPLSTSDVLQSKSTSEIPAEYHELADLAADSSSPSGTQQLDTDPGRPSEEPCFPLASAL
KELHKLLVISRKGECKILASEEVSQLEMVHKEPAVQQKGLPEGEQKGSDPASQEQSCSFP
ETRSEGGGTEGSQPCDSGREHISTRPVAPGQPVLGGGALERQKGSGKSDVVVLSSAATPG
QEQSPEQREVLAGGSQNAPSPALEQSTPVSSTPAPGEGAPQGTWRLFTGAPGRSGSAAPA
GPWPLGGSEEPLLSPPAAYTRLTTGASPAPAFPVADVDRILGAGFTPQEALQALEQAGGN
ADLALLILLAKSIVVPT
Download sequence
Identical sequences H1A5A2
ENSTGUP00000018068 59729.ENSTGUP00000018068 ENSTGUP00000018068 XP_012425807.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]