SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018073 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018073
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 80-156
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.9e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018073   Gene: ENSTGUG00000018243   Transcript: ENSTGUT00000019167
Sequence length 156
Comment pep:novel chromosome:taeGut3.2.4:19:8091424:8091891:1 gene:ENSTGUG00000018243 transcript:ENSTGUT00000019167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Download sequence
Identical sequences H1A5A7
59729.ENSTGUP00000018073 ENSTGUP00000018073 ENSTGUP00000018073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]