SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018141 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018141
Domain Number 1 Region: 3-234
Classification Level Classification E-value
Superfamily L domain-like 3.23e-33
Family Internalin LRR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018141   Gene: ENSTGUG00000018128   Transcript: ENSTGUT00000019270
Sequence length 260
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:89846656:89912708:-1 gene:ENSTGUG00000018128 transcript:ENSTGUT00000019270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLTDISLLEGFIHLRYVDLSKNKLKDLAPLSSLTQLLWLKVDGNLLTSASMQELPYLQV
ISFDRNRIMDFEGITHPLLANLSLKENKIETVQGLSHNQLFSLEVLELRGNRIKTTAGLG
VSKLKKLYLAKNTICSLEGLEEFEQLETLHLRDNKLEALDGFSNSMKCLQYLNLRSNGIK
SFQEVEKLQVLPMLQALVLMDNPCAEEPTYRLEVLSRLPQLQRLDKESIEEEEREEAEKI
CQARKEKEKQQPEAKRPPEP
Download sequence
Identical sequences H1A5H5
ENSTGUP00000018141 59729.ENSTGUP00000018141 ENSTGUP00000018141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]