SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018305 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018305
Domain Number 1 Region: 90-223
Classification Level Classification E-value
Superfamily Cupredoxins 2.35e-59
Family Periplasmic domain of cytochrome c oxidase subunit II 0.00000277
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 1.44e-26
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018305   Gene: ENSTGUG00000018750   Transcript: ENSTGUT00000019466
Sequence length 227
Comment pep:known chromosome:taeGut3.2.4:MT:7100:7783:1 gene:ENSTGUG00000018750 transcript:ENSTGUT00000019466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANHSQFNFQDASSPIMEELMGFHDHALMVALAICSLVLYLLTLMLTEKLTSNTVNAQAI
ELVWTILPAMVLVMLALPSLRILYMMDEINEPDLTLKAIGHQWYWSYEYTDFKDLTFDSY
MIPTTDLPLGHFRLLEVDHRVVIPTSSTIRVIVTADDVLHSWAVPSLGVKTDAIPGRLNQ
TSLFASRPGVFYGQCSEICGANHSFMPIVVESTPLANFESWSSSISS
Download sequence
Identical sequences Q27GW5
YP_514822.1.42559 ENSTGUP00000018305 ENSTGUP00000018305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]