SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000052 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000052
Domain Number 1 Region: 39-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.85e-55
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 384-426
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000183
Family SOCS box-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000052   Gene: ENSTGUG00000000054   Transcript: ENSTGUT00000000052
Sequence length 434
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:127472:136577:1 gene:ENSTGUG00000000054 transcript:ENSTGUT00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDSCSVRSHHSEHSLSPEGWGHQHSRLEPLECQDLLVQNALFTGDLDMVQKYFTKSAAVN
LIIETRGDVLRWTSSKRGLWSLSYEQELTTPLHITAGRGYADCLRLLLLRGAAVDFAPGG
KTALHEACAAASTACVRLLLGSGADPEAVSEDGYRPLHLCKSSDSLECVQLLLQHGASVN
SQTEEEKDTALHVASRHGLAEHVRLLLHQGAELEVKNKEGQTPLNAACAQHHQPQDMDRY
YRVCQLLVESGASINAEDRDRQHPLHLACKNANAQIAELLLARGANVNVMNYGGNTALHN
ILQVAAYKLEHHPELVVRALLNHGAVRIWPGSLLKVLRCCHSCPRVIEALVNSYSHVRVS
EDWEEAVPAEVVQKYPCFYQSLFSLGHRPRSLQHLARCTLRTLLEGRLLLVLSQLHLPSA
LHQFLLLGFEDVLY
Download sequence
Identical sequences H0YP55
ENSTGUP00000000052 ENSTGUP00000000052 59729.ENSTGUP00000000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]