SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000214 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000214
Domain Number 1 Region: 29-382
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.6e-57
Family beta-glycanases 0.0017
Further Details:      
 
Domain Number 2 Region: 374-548
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-39
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000214
Domain Number - Region: 528-613
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00372
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000214   Gene: ENSTGUG00000000205   Transcript: ENSTGUT00000000217
Sequence length 629
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:3492704:3537091:-1 gene:ENSTGUG00000000205 transcript:ENSTGUT00000000217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLLWLLLVPLGCAAYEVYVDARRAERPLRHFWRSTGFCPPLPHNRADLFDLSKDQELN
LAYISSVPHGGIEQVRIHWLLELVALRVVNGKLNYDFTALDNLMDRLWQNKLIPGFELMG
NPSGYFLDFEDKEHVVQWRNLITVLARRYIDRYGLEHVAKWNFETWNEPDHHDFDNVSMT
VKGFLNYYDACSEGLRAASPFLKFGGPGDSFHPLPKSPMCWGLLCHCYNGTNFFTGETGV
RLDYISLHKKGDGNSLYILQQEIEAVQQIQKLFPSFSSVAVYNNEADPMVGWSIPQLWRA
DVTYAAMVVKVIIQHQNLLISKANNTINYSLLSNDNAFLSYYPHYFTQRTLTARFQMNNT
KPPHVQMVRKPVLTAMGLLALLGEKQIFAEVKIRGDESAENSTVGVLASVHTPSETQPSD
SWQATVLMYSSEDNRTSSNISTVIVNATHFPKHREMVYVMYYMDNNQTNPYLKWKNLGSP
DFPSPEQFQQIRDTEDPLVTGPFPFPEAGILTLKQDFPVPSVFLIHICARPRSAPDQVTG
VRLIPLTKGQVIVLWDDECVKSKCIKTFEVEFSSDGQVYQRINAKDTIFTLWVYSPGSSV
SGFYRVRAIDYWGKAGLSSLPVGYIEAFK
Download sequence
Identical sequences H0YPL5
XP_002188791.1.42559 ENSTGUP00000000214 ENSTGUP00000000214 59729.ENSTGUP00000000214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]