SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000897 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000897
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Cupredoxins 2.13e-45
Family Ephrin ectodomain 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000897   Gene: ENSTGUG00000000877   Transcript: ENSTGUT00000000908
Sequence length 159
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:4139793:4145577:-1 gene:ENSTGUG00000000877 transcript:ENSTGUT00000000908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFHRGDYTVEVSINDYLDIYCPHYEEPLPERMERYILYMVNYEGHASCDHRQRGFKRWEC
NRPDSPNGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISASPPNTVDRPCLKLKVYVRPTN
DSLYESPEPIFTSNNSCCSLRVPPAALAVVPLAWTLLLS
Download sequence
Identical sequences H0YRI8
59729.ENSTGUP00000000897 ENSTGUP00000000897 ENSTGUP00000000897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]