SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000910 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000910
Domain Number 1 Region: 398-564
Classification Level Classification E-value
Superfamily SPOC domain-like 3.1e-48
Family SPOC domain 0.0002
Further Details:      
 
Domain Number 2 Region: 9-163
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-28
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000910   Gene: ENSTGUG00000000886   Transcript: ENSTGUT00000000921
Sequence length 566
Comment pep:known_by_projection chromosome:taeGut3.2.4:26:207714:209575:1 gene:ENSTGUG00000000886 transcript:ENSTGUT00000000921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPEDDQRANRTLFLGNLDITVSESDLRRAFDRFGVITEVDIKRPGRGQTSTYGFLKFENL
DMAHRAKLAMSGKVLLRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTI
DYRKGDSWAYIQYESLDAAQAACTHMRGFPLGGPDRRLRVDFADTEHRYQQPYLQPLPLP
PPAHYELVAEAAAFGAHRGAPPDPLRGARDRTPPLLYRDRDRDLYPETEWVPPPPPVRDR
SNRAAAYDPLESLERRRDGWSLERDRGERELGSSSRDQPKKRRLAEDGGRALGPAPLPLR
KRHCLATTFSSRTAAPSSSGGRERDSSDERSSRFAPSWRRPFPIRGVPRRGQPGSGSRTK
ARPQELAERERKHASLLPSECKRWNRAGPGAAPKLCLGRGMLLLKNSNFPSNMHLLQGDL
GVASSLLVEGATGGKVAQLKITQRLRLDQPKLDEVNRRIKVAGPNGYAILLAVPGASDNR
SAAGAAEAATTSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENSGVLHAFPPCDFSQQ
FLDSTAKALAKSEDDYLVMIIVRGAS
Download sequence
Identical sequences H0YRK1
59729.ENSTGUP00000000910 ENSTGUP00000000910 ENSTGUP00000000910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]