SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001016 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001016
Domain Number 1 Region: 142-384
Classification Level Classification E-value
Superfamily vWA-like 1.08e-83
Family Integrin A (or I) domain 0.000000194
Further Details:      
 
Domain Number 2 Region: 643-731
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.53e-23
Family Integrin beta tail domain 0.00071
Further Details:      
 
Domain Number 3 Region: 357-473
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-21
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 30-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000481
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 601-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Integrin beta EGF-like domains 0.004
Further Details:      
 
Domain Number 6 Region: 559-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000001016
Domain Number - Region: 525-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001016   Gene: ENSTGUG00000000968   Transcript: ENSTGUT00000001028
Sequence length 803
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:15479668:15505585:1 gene:ENSTGUG00000000968 transcript:ENSTGUT00000001028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQTNFKWLTCAGILCCLIWNGCAQQGGSDCIKANAKSCGECIQAGPNCGWCKKTDFLQE
GEPTSARCDDLAALKSKGCPMEDIENPRGSKQVLENREVTNRKKGAAEKLKPEAITQIQP
QKLSLHLRVGEPQTFSLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTALMLEMEKI
TSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTSEGNKFNELV
GKQHISGNLDSPEGGFDAIMQVAVCGEQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLP
NDGKCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSA
VGTLSSNSSNVIQLIIDAYNSLSSEVILENTKLPKGVTISYKSFCKNGVNDTQEDGRKCS
NISIGDEVRFEINITANECPKKEQNETIKIKPLGFTEEVEINLQFICECQCQSEGEPNSP
ACHAGNGTFECGACRCNEGRIGRLCECSTDEVNSEDMDAYCRRENSTEICSNNGECICGQ
CVCKKRENTNEVYSGKYCECDNFNCDRSNGLICGGNGICKCRVCECFPNFTGSACDCSLD
TTPCMASNGQICNGRGTCECGTCNCTDPKFQGPTCEMCQTCLGVCAEHKDCVQCRAFDKG
EKKETCSQECMHFNMTRVESRDKLPQPGQPDPLSHCKEKDVDDCWFYFTYSVNSNGEANV
HVVETPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKW
DTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H0YRV7
ENSTGUP00000001016 59729.ENSTGUP00000001016 ENSTGUP00000001016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]