SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001989 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001989
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-26
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 262-377
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-25
Family Cadherin 0.00078
Further Details:      
 
Domain Number 3 Region: 373-496
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-24
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 482-587
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 5 Region: 78-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001989   Gene: ENSTGUG00000001926   Transcript: ENSTGUT00000002007
Sequence length 789
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:37047860:37106283:-1 gene:ENSTGUG00000001926 transcript:ENSTGUT00000002007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQQVLLLVLLWMWLPHPCHTEMLFRRTPDLRPKSFGGRALGNDGKAIHRQKRGWMWNQ
FFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDRE
EKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEVYTASVPEMSVVGTSVV
QVTATDADDPSYGNSARIIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAK
DMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTIHLRIPESSPVGTAIGSVKATDADTGK
NAEVEYRIIDGDGTDMFDIVTQKDTQEGIITVRKPLDYETRRLYTLKVEAENTHVDPRFY
YLGPFKDTIIVKISVEDVDEPPVFSRSSYLFEVHEDIELGTIIGTVMARDPDSASSPIRF
SLDRHTDLDRIFNIHSGNGSIYTSKPLDREISQWHNLSVIAAEINNPKDTTRVPVYVRIL
DVNDNAPQFAVFYDTFVCENARAGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDN
EDNTARILTRRNGFSRHEISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSRGNMQSCSA
EALLLPAGLSTGALVAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDE
GGGEEDTQAFDIGTLRNPAAIEDKKLRRDIIPETLFVPRRTPSAPDNTDVRDFINQRLKE
HDTDPSAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQNYDYLREWGPRFNKLAEMYG
GGESDKDTS
Download sequence
Identical sequences H0YUM0
ENSTGUP00000001989 ENSTGUP00000001989 59729.ENSTGUP00000001989 XP_002199117.1.42559 XP_012426976.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]