SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002323 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002323
Domain Number 1 Region: 281-524
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.17e-54
Family Crotonase-like 0.0000000107
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Chromo domain-like 5.18e-18
Family Chromo domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002323   Gene: ENSTGUG00000002246   Transcript: ENSTGUT00000002344
Sequence length 537
Comment pep:novel chromosome:taeGut3.2.4:2:43865767:43921475:1 gene:ENSTGUG00000002246 transcript:ENSTGUT00000002344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVERIVDKRKNKKGKTEYLVRWKGYNSEDDTWEPEQHLVNCEEYIHEFNRRHNEKQKEST
LTRTNRTSPNNARKQISRSTNSSFSKTSSKSLVMAKEHESKNSQLFSATQKFRKNNSPSL
SGRKNMDLAKSGIKILVPKSPIKSRTTVDGFQNESPDKMDHIEQDQDDSVAPEVAAEKPV
GALLGPGAERARMGSRPRIHPLVPQLPVPVTATIPSALTINGKGTPTFMEALAANGTTNI
QTSVTGVTASKRRFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTKS
SENNSLNPEVMKEVQSALNTAAADDSKLVLFSAVGSIFCCGLDFIYFIRRLTDDRKKEST
KMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQS
PDGCSSLTFPRIMGLASANEMLFSGRKLTAQEACAKGLVSQVFWPGTFTQEVMVRIKELV
TCNSVVLEESKALVRNIMKVDLEQANEKECEVLKKIWGSAQGMDSMLKYLQNRIDEF
Download sequence
Identical sequences H0YVK2
ENSTGUP00000002323 59729.ENSTGUP00000002323 ENSTGUP00000002323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]