SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002963 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002963
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000706
Family PB1 domain 0.00025
Further Details:      
 
Domain Number 2 Region: 220-269
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000177
Family ZZ domain 0.016
Further Details:      
 
Domain Number 3 Region: 908-946
Classification Level Classification E-value
Superfamily UBA-like 0.00000000851
Family UBA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002963   Gene: ENSTGUG00000002873   Transcript: ENSTGUT00000002992
Sequence length 952
Comment pep:known_by_projection chromosome:taeGut3.2.4:27:2784773:2807763:1 gene:ENSTGUG00000002873 transcript:ENSTGUT00000002992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRLTVRVTRRGDTRTFLLPDPARTAWADVEAMVKVSFDLDNIQIKYIDEDNDEVKYLP
PPPPNKSTKKWLIAVKQGNQLQMNVYEKNPSHALQLHEKNVTEKLVLLKDEKKPLLQYST
IAQGLEEELKNDQELTIQSLPSGKCQTESTNENPPEWFTSYLETFREQVVKETVERLEQK
LYEKLVHCSQPADVCESSFAAAPAESPSGSGSSSQCDWLISCCSCQARIVGVRYQCSLCP
AYNICEECEAGTYAHDPNHVLLKLRRPIPCGADSYSLAELAPRLPATLEQVRLQKQMDKR
FLKAEKQRLRAEKKQRKAEVRELKKQLKLHRKIHLWNSIHVLETNSSPTLKSESVQPNTF
LSPNQPFQAIVPTLSAVFVDENLPDGTHLKPGTKFIKHWRMKNTGNVEWSSDTKLKLMWG
NLTLASAEKKDVIVPSLPSGQVGTVSVEFVAPNIEGTYTSHWRLSHRGEQFGPRIWCSIV
VDPSPAADYERNATYIAFISSKVWDLCCQKELTLLTGDCAQLIGEIAEQAEISLPAVPLK
IKNLPSEREFYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPRDSP
LLEKPGLDQIEEENEGSGFKLVPESILAEAGRAEHALNQEEGEEDMSGTQFVCETVIRSL
TLDAAPDHKPPQKNPKILQKSPMINSNSTSKKEAKIHPLEPSTSPRSGTGNCDEEEDDKD
DVQSQCSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLEKTGEPETVAENAEGGSQ
PQIQRVSDTVTTSQMLAAVPLTPADVDSLPQAQRYDLQEQNGDAGIAVESARSKIIDVVD
QIRASIMGNGQRILKSTYSTWSPHRYPQGSSIAGELVKGALSVAASAYKALFAGPPIIEQ
PAAPEEQTASLLSSLCEMGFCDRQLNLQLLKKHNNNMIEVVTELLQISNRDW
Download sequence
Identical sequences H0YXD7
ENSTGUP00000002963 ENSTGUP00000002963 59729.ENSTGUP00000002963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]