SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003494 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003494
Domain Number 1 Region: 8-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-28
Family Laminin G-like module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003494   Gene: ENSTGUG00000003397   Transcript: ENSTGUT00000003530
Sequence length 231
Comment pep:novel chromosome:taeGut3.2.4:17:5124837:5138017:1 gene:ENSTGUG00000003397 transcript:ENSTGUT00000003530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSWTTAASPIPQGVIPFKSGVIFTQRARVEAPLSTLLPAGSSSDLLLVLSLCSHRINNAF
LFAVRSKKKKLQLGVQFVPGKIIVYVGHKRSVYFDYNVHDGQWHNMAINIRGQTVTLFTS
CGKRRVHADLHFKKDEALDPHGSFLFGKISQHAVQFEGAICQFDIYPSAKAAHHYCKYLK
KQCRQADTYRPNLPPLIPLLPRDPSASPSTPQRTEPSLQGLKNLTTAAPNL
Download sequence
Identical sequences H0YYW2
ENSTGUP00000003494 59729.ENSTGUP00000003494 ENSTGUP00000003494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]