SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003713 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003713
Domain Number 1 Region: 962-1070,1102-1314
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-61
Family p120GAP domain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 13-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.08e-39
Family Calponin-homology domain, CH-domain 0.0000122
Further Details:      
 
Domain Number 3 Region: 1534-1631
Classification Level Classification E-value
Superfamily RGC domain-like 7.45e-32
Family RGC domain 0.00000995
Further Details:      
 
Domain Number 4 Region: 724-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000518
Family Motor proteins 0.038
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003713
Domain Number - Region: 661-686
Classification Level Classification E-value
Superfamily WW domain 0.0815
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003713   Gene: ENSTGUG00000003501   Transcript: ENSTGUT00000003753
Sequence length 1631
Comment pep:known_by_projection chromosome:taeGut3.2.4:25:190889:205438:-1 gene:ENSTGUG00000003501 transcript:ENSTGUT00000003753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERPTADEMDEQRRQNVAYQYLCHLEEAKRWMEACLGEGLPPPTELEETLRNGVLLAKLGH
CFAPAIVPLKKIYDPEQTRYKTAGLHFRHTDNINYWRDAMSHVGLPSIFHPETTDIYDKK
NMPRVVYCIHALSFYLFKLGLAPPIQDLYGKVNFTEEEINNMKRELEKYGLQLPAFSKIG
GILANELSVDEAAVHAAVLAINQAVDRGVVAQTMEALQNPHAALLGLRQELAAAYQELLH
QAKLEKGSNATNRVRGHRDVYDWCLTQAEIQGNINKVNGEQSWVFHLGFSRAHGGTMAAL
GMGRVVGLAEVSLLRPASDLEGRRAGCGMIYLLTSGVNWPLAVRGALEEVDYDLQRLDVL
ALHLLQAVGRINAAVRQGVPAETLEALMEPAAQLPDVHAPAASLYQHQLALLQSQHPRGE
LAQEELFVAVEMLSAVALVNQALDARSPNRLWRNLVSPALGLSGAEDANAQRYFDDLLQL
KGQLRKAGAEFLSWNDIQDSIASTNSSVQDENDRSRVLGLLHEALLQADPEKTLAALLLL
VPALPGLALPTAPRYHAVLARARRHKAQATQDNGAALGWEEIQEGVCQANQDTVAARRMA
LGIAAINQAIKEGKASQTLRVLCNPDVALCAVVNACAGAYQEQLAALMATKRPAGSTELS
WVRHRLLDGAEYYLNLQSLEGSWQCPRSGSFNTTHLSREEIQSVITRVTLSHERECLWAS
SVALVVRLQARLRGFLVRRQLAARRHVLQEQRPAATRIQACWRGYRQRRAYLDRLHYLKS
NTEAAIKIQAAVRMWQARRKYQERLHYFRQNVSDGIRVKPLLGLAKPLQFHKKPNNDFKM
PIKRGRKFWGEKGALIHSWQWDQAVMCLSSSPSLPICVRDTMKKHLPPLCLSWQIKAVIK
IQAFVRANKARGDYRMLEPWWSLVISPGAAPLPPKASQRLLQCGRVLSHVLVFLGNRMGC
DLIFQMPQNKSTKFMESVIFTLYNYASNPREAYLLLQLFKVALQEEIRSKVDHVHDILTG
NATVVRLVVSFYRSERGQNALRHILAGPVQEVLQDRALSIHTDPVDIYKAWVNQTESQSG
HRSKLPYEVSPEQALSHPEVQRRLDISIRNLLAVTDKFVSAITSSVDKIPYGMRYMAKIL
RMSLVEKFPKAPAEEVDKIVGNLLYYRFMNPAVVAPDGFDIVDVSAGAALRPEQRRSLGC
IAKVLQHAAAHRPFQGDSAHLCGLNQYLEHTHSKFRRFISAACCVPEPEERFDMDEYSEM
VAVAKPVIYITVGELINTHKLLLEHQDSITSHHSDPLHELLADLDELPTVQSLVGESVAS
LGDSSAEQLSRTEISLTLTNKLVPVASSEESDTRSLLLSTKQMLVDLIQCQAGDSLPEIL
WTPASQHEEAAHEQLLCQRALRDAQPSAQLRRHPSLAANARLSMQEKKRKVTRNLRRLES
LGLLDSANQYQGLIDQLAKDIRNQWRHRQQRRREILKLRQTLEGLDAKTLFYEEQIDYYN
QYIKTCLDNLAVSNKCDSLPKISSLKKKTKKLPSLHYTAAQLWEKGVLLEIQDLPPSQLR
NVVFDIIPCEESGRFQVKAKFMGIDMEHFQLHYQDLLQLQYEGVAVMKMFDKAKVNVNLL
IFLLNKKFFKK
Download sequence
Identical sequences H0YZH9
59729.ENSTGUP00000003713 ENSTGUP00000003713 ENSTGUP00000003713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]