SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003772 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003772
Domain Number 1 Region: 964-1127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-34
Family SPRY domain 0.00063
Further Details:      
 
Domain Number 2 Region: 770-960
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-19
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 3 Region: 571-620
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000143
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003772
Domain Number - Region: 622-695
Classification Level Classification E-value
Superfamily PhoU-like 0.0401
Family PhoU-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003772   Gene: ENSTGUG00000003634   Transcript: ENSTGUT00000003814
Sequence length 1132
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:55623395:55652835:-1 gene:ENSTGUG00000003634 transcript:ENSTGUT00000003814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQKDLFNIISEGYEILNIHAPTHISSVDQEESKHMPDKLEYLETNPSFRRKSVEDGQRAL
TSGRTTEISESSVLEKTASHELIELETEETQQENLPLPEDNNCAKLDPNNGTGDMDYFEK
YTLIDDKSPVKPQFERPISLSPVTEDPNEPMEEVKSFEESTEVDTLEEFSLLEDLDEVFY
GTIKGESKIQSYTDASKSLPLQKSIDSSSKSITNVEDECKSPGTPLFDSEEGVLERSLLF
PTTVAAINPELLEEPPALSFLYKDLYAEAVGEKTKDETPSDEESGNSNASFPSRNSDTDD
GTGMYFEKYILKDEIPKDDSENKQEQGSGDVQYVKTEVLYQSSQSKKDTVIKWIIRELPY
QDASTNQEELQIHRHFPQWHRMVPYVRAPTGKLTRAVKSTKIQSSSGYQGAAYQEASTKQ
EELQDTTAFPQMEKYVPYVRAPTEDSVDDQFTQEHLSCVPTIQQTENPDLQREEQHGDIY
EDFAESMDYDVITQEELLQDEISSQFTHEELLFEDRDSFDHAADSYEFVNEPEQRTPIEL
EDSGFVVMYPEKSATNIPQVESPQRELKKSQVDTYCYHCKCPISAIDKLFGEHKDHEVTT
LDDAATKMKDQLSKLLTALEEKSMKIEEFVSDIELRFNSVEENCKKNADLLEKQNEEMLK
KVVAQYDEKSENFEEVKKMKMEYLYEQMVNFQQTVDSAKETLETTVKETDEVDGFVFLNV
NTCFLPIRLLSAMDTTLSLEKVPSAFSLFEHFADSPGQSNQHSLQHVAVPQTPTVIPQEP
NSATSTSIAVYWAVNDGDTIDCFQVYCTEELQASKDAGALVEEYRVTVKESHCILEDLEP
DRCYSVWVMAVNGTGCSLPSEKAIFKTAPAVPSIKAEDCTVCWDTATVRWLSSSLSAESF
IVEYCRQHSPEGEGLRSFAGIKKPELKVSLEPNVNYFFYLRAVNPFGTSEQSEAALISTK
GTRFHLLSDTAHPALQISSNATVIHLPEKTKLSGFPSVLGELLPAQGCHYWEIVVSACRS
YRIGICYEAITQSSVLGLSDTSWCMRCCPTQTRFLHTGVMSDVHVTEHLARIGILLDYNS
GRLLFFNAERGLVLFAIRHKFTDAAHPAFALEKAGMLTLCTGMELPDFVKQS
Download sequence
Identical sequences H0YZN8
59729.ENSTGUP00000003772 ENSTGUP00000003772 ENSTGUP00000003772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]