SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003845 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003845
Domain Number 1 Region: 5-458
Classification Level Classification E-value
Superfamily Sema domain 9.42e-131
Family Sema domain 0.0000000166
Further Details:      
 
Domain Number 2 Region: 454-474
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000296
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003845   Gene: ENSTGUG00000003695   Transcript: ENSTGUT00000003887
Sequence length 474
Comment pep:known_by_projection chromosome:taeGut3.2.4:25:310005:313100:1 gene:ENSTGUG00000003695 transcript:ENSTGUT00000003887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDPRRTLTHFSQDNISHYDIFLLDESEEELYVGARDWVLALAVGTPGSIRAKASIMWGAT
DEKTSECAFKKKSQETECFNFIRVLVALNQTHLYVCGTYAFSPACTYIHLENFTLVPSGR
GQPFLDGKGQCPFDPKHTYTALLVDGELYAGTMNNFQGNEPIISRSLGTRTLLKTDAFLR
WLSADAAFVASFSIPEDDKVYFFFEETADEFDFFEKLLVPRVARVCKVDVGGEKLLQKKW
TTFLKAQLVCSQTGHFPFNVIHHTFALLRHDGRADFYAVFTSQWQAGRAGSAAVCAYRQE
DLEKVFEGKYKELNKESSRWTVYSGPDMSPRPGSCSMGASSDKALSFMKDHFLMDGKVSP
MRGQPLLVKSDVTYTRITVHETRGVQDIPSWIMSCGSDTGIRDQTQDSFGQSSHLESIQL
FARPEPVKNLLLAPGKGILYVGYSRGVLQVPLANCSLHRSCAECVLARDPYCAW
Download sequence
Identical sequences H0YZW0
ENSTGUP00000003845 59729.ENSTGUP00000003845 ENSTGUP00000003845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]