SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003849 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003849
Domain Number 1 Region: 33-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-65
Family SPRY domain 0.000000015
Further Details:      
 
Domain Number 2 Region: 234-271
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000471
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003849   Gene: ENSTGUG00000003743   Transcript: ENSTGUT00000003891
Sequence length 272
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:5171575:5175110:-1 gene:ENSTGUG00000003743 transcript:ENSTGUT00000003891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPVYRPLKQELQGLDYSKPTRLDLLLDMPPVSYEVQLLHSWNNDD
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRTHAVVGVATAE
APLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVVL
DMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMCYLNGLDPEPLPLMDLC
RRAVRLALGKDRLAQIPTLPLPASLKSYLLYQ
Download sequence
Identical sequences H0YZW4
ENSTGUP00000003849 59729.ENSTGUP00000003849 ENSTGUP00000003849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]