SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004150 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004150
Domain Number 1 Region: 741-884
Classification Level Classification E-value
Superfamily Spectrin repeat 2.13e-37
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-36
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 102-251
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-35
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 4 Region: 1692-1838
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-34
Family Spectrin repeat 0.0000024
Further Details:      
 
Domain Number 5 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-34
Family Spectrin repeat 0.0000586
Further Details:      
 
Domain Number 6 Region: 1186-1315
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-33
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 7 Region: 309-464
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-32
Family Spectrin repeat 0.0007
Further Details:      
 
Domain Number 8 Region: 1374-1512
Classification Level Classification E-value
Superfamily Spectrin repeat 4.12e-31
Family Spectrin repeat 0.0000358
Further Details:      
 
Domain Number 9 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-30
Family Spectrin repeat 0.0000167
Further Details:      
 
Domain Number 10 Region: 1800-1934
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-30
Family Spectrin repeat 0.00000621
Further Details:      
 
Domain Number 11 Region: 1903-2058
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-28
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 12 Region: 1478-1601
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-27
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 13 Region: 1606-1728
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-26
Family Spectrin repeat 0.00000311
Further Details:      
 
Domain Number 14 Region: 2290-2426
Classification Level Classification E-value
Superfamily EF-hand 6.32e-24
Family Calmodulin-like 0.0038
Further Details:      
 
Domain Number 15 Region: 2065-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 16 Region: 967-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 2182-2297
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-19
Family Spectrin repeat 0.00093
Further Details:      
 
Domain Number 18 Region: 1037-1142
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-19
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 19 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 20 Region: 472-546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000187
Family Spectrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004150   Gene: ENSTGUG00000003937   Transcript: ENSTGUT00000004195
Sequence length 2453
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:5682590:5721449:1 gene:ENSTGUG00000003937 transcript:ENSTGUT00000004195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELEKWI
QEKLQIASDENYKDPSNLPARLQKHQAFEAEVQANSGAIIKLDETGNQMINESHFASETI
RTRLQELHRLWELLMEKMREKGVKLLQAQKLVQYLRECEDVLDWINDKEAIVTSKELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQETHPEEELIKSKQDEVNASWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLSAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MDDVATRRDALLSRRNALHERAMYRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVKHYASDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIKKKQEALVARYEALKDPMVARKQKL
ADSLRLQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQYHSLLELGEKRKGMLEKSCKKFMLFREA
NELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDLKANESRLKDINKVAKDLESE
GLMADEVQAVQQQEVYGMPRDETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQL
AEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERD
LAALGDKVNSLGETAQRLIQSHPESAEDLQEKCTELNQAWNSLGKRADQRKEKLGDSHDL
QRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARTGTFQAFEQF
GQQLLAHGHYASPEIKEKLDILEQERTDLEKAWVQRRMMLDQCLELQLFHRDCEQAENWM
AAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQSFADQLIAADHYAKGV
IANRRNEVLDRWLRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKD
PTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARLAALADQWQ
FLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQ
LLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKGMASARRAKLN
ESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQ
GVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEE
EEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNN
HHEANITAKMKGLRGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKT
DDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASL
MKRWNQLLANSATRKKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCN
SLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRN
LQKIIKAIERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRYTHQDLSCMVEESG
TLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQ
LGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDL
PMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSE
GKPYVTKEELYQNLTREQADYCISHMKPYMDGKGRELPSAYDYIEFTRSLFVN
Download sequence
Identical sequences H0Z0R3
ENSTGUP00000004150 ENSTGUP00000004150 59729.ENSTGUP00000004150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]