SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004354 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004354
Domain Number 1 Region: 1158-1220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-18
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 64-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000125
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 118-188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 979-1042
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 5 Region: 1100-1159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000157
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 914-977
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000944
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 7 Region: 1032-1094
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000189
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 8 Region: 613-669
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000038
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 792-846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000148
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 546-607
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000162
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 11 Region: 186-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000249
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 243-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000341
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 13 Region: 492-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000059
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 14 Region: 433-497
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000796
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 15 Region: 7-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000459
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 16 Region: 673-728
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000223
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 17 Region: 859-930
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000089
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 18 Region: 370-426
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000123
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 19 Region: 307-371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000275
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004354   Gene: ENSTGUG00000004224   Transcript: ENSTGUT00000004400
Sequence length 1220
Comment pep:novel chromosome:taeGut3.2.4:8:4368597:4391517:1 gene:ENSTGUG00000004224 transcript:ENSTGUT00000004400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEEPPPRRVKEVPTKRWDSPPYPHGTQATYNCRPGYVKMGRIAFRCIDGAWKQVAPVTEC
RNKPCGHPGDTEFGVFELTSGSEFVFGARVEYRCNDGYQMLSQRNYRECQADGWSNDIPH
CEVIKCLPVQEPENGRIIMTGAFELGQEYSFGQVVNFECNANHKLVGAKEIICSANGEWS
NDVPQCEEIICAVPEIPHGYVRSPKKSYKENELIQFFCKEGYKYGNRADALCTGLGWNPP
PYCTEIVCSPPVISSGNFRPQKDKYILGNTITVECDDGYHFKAMTGRTTAECTKNGWVPD
PACVRKPCDYPLIENGKLSSSYENYRNYYFPQRFGQTVDYYCLEGYLTPTGDYWVRITCS
EKGWFPEPKCLNKTCFHSNLHTSVFFWNNFYKEGERARYVCYDNYEAQHEEVTCTRNGWA
PAPRCTRKSECACCHHIIFENGYLNLYQETYNLKEKILYTCHAGFVTPEGQETGHTQCQE
SGWTPPPKCIKSCKAPGDILIHHTKKTVFMPEDTIEYSCLEGYKTTNNMPTDSTMCGKNG
EWSPEPQCREIECALLPLSNGDFSPKKGKYHSGAVVKFTCAKNYIRVGSASTQCYHFGWF
PSPPVCQVSVKGCGPPPEIPSGSIVDGSVEQYQHGDRKQYECNGDFKLVGSKEIECIDGQ
WSPLPSCIARSRKCSNLNQLKFSLLFMAYVPTYSHGDEVTCGCKPGSDNTEEMKIKCLNG
EWKPLPVCAGNLQLFKGIKNNVNSHNVLHLSKSIFKFFLFFFRCIPSMCDSRVCCAGALW
PVSHCCLTEESVCPPPPQVPGALQTTVGRNFRNGSKASFSCPDGFELIGTKEITCIEGKW
QSPPYCVGKQPCFSPKSVECADAPRLENTNLRIEREGKTIYLPGARFKYVSRPGYMLNGP
TEINCSMGNWTAAPSCLEMPCGSVPKVANAHFEGRQKESYEPGETVQYHCDSGFLIVGSL
EIICRKGNWTAPPFCEDVSCGAAPEIPNARIASAPQDRYLPGARVHYQCERNFQMMGRND
ILCSNGQWSQPPVCRDVTCNPPVEIAGGRIDGIRKSRYMPGETAKYQCWKNFKMTGTSTV
VCKNGTWTDPPTCKGQGGRCGTPPAIQSGELLVFPLQEYQQGDTVEYKCPDFYILKGSST
ITCLNGQWTSPPVCLVACTASEEDMDSNNIELKWVGQAKLYSTSGDYIEFRCKQGYLKDP
STPNFRVQCVEGTLKYPRCT
Download sequence
Identical sequences H0Z1B6
ENSTGUP00000004354 59729.ENSTGUP00000004354 ENSTGUP00000004354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]