SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004544 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004544
Domain Number 1 Region: 56-309
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-30
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 375-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000379
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004544   Gene: ENSTGUG00000004412   Transcript: ENSTGUT00000004592
Sequence length 441
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:6030701:6179809:-1 gene:ENSTGUG00000004412 transcript:ENSTGUT00000004592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGQGTMPFLHGFRRIVLEYQPLVDELLGLLATPDTEGQSSLESPACLDSDSQVSAVRRV
LEREIHSPFYQEGVSYALLKVTELGLVPAAEILLEFGADLSFEDPVTYYTPLHMAVLRNQ
PDVVELLVRHGADINRRDRIHESSPLDLASEEPERLPCLRRLLRLGADVNAADKNGKTAL
LHALASSDSGQIHNTDSIRLLLEGGADVRAATKDGDTVFTYVIYLLGEMAYSYSEEEAED
IERFCFRVTQLLLAHGANPSECPASESLTHFCLKSFKDYFPLLRFLLESGAAYNCSLHGP
SCWSGFHIAFEHLCWHLSRFDDETYSSDLMQKGQTLLELMMASSQAIQLPSNFEVNTSSC
RFHGEKVQTLFCSLKQLERSPQALKHLCRVFIRQRLKPWPVDDKIKALPLPDRLKWYLLI
DHAAAGHEDLPHHPDSPSPHT
Download sequence
Identical sequences H0Z1V4
ENSTGUP00000004544 59729.ENSTGUP00000004544 ENSTGUP00000004544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]