SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004988 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004988
Domain Number 1 Region: 375-555
Classification Level Classification E-value
Superfamily SPOC domain-like 2.24e-49
Family SPOC domain 0.00033
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.56e-31
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004988   Gene: ENSTGUG00000004850   Transcript: ENSTGUT00000005038
Sequence length 557
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:4554043:4555716:1 gene:ENSTGUG00000004850 transcript:ENSTGUT00000005038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPSTSLAALAREFDRFGSIRTI
DYVKGDSFAYIQYESLDAAQAACAQMRGFPLGGPERRLRVDFAKAEETRYPQQYQPAPLP
VHYELLADGYSRHRSLEQDLRVRDRTPPHLLYSDRDRSFVEADWASPAKNAERRNNLESY
SRSVRSRSGERWGSDGDRSVPKPWEERRRRRSLSSDRGRTTHSPYEDRSRTKASGPALDR
SPDRARKENHTTEPGAEKEQSNSLQNNRHAAEEKPHREPADAPQPKKRDSERNHRTGESE
SKTHEEPKSETKKLKNLSEYAQTLQLAWNGLLVLKNSCFPTSMHILEGDVGVINGLLKDH
SSGGKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQSAPAGAGAEGTFPVVE
PGLQRRLLRNLVSYLKQKQAAGVISLPVGGAKGRDSTGMLYAFPPCEFSQQYLQSALRTL
GKLEEEHMVIVIVKDTA
Download sequence
Identical sequences H0Z346
ENSTGUP00000004988 59729.ENSTGUP00000004988 ENSTGUP00000004988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]