SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005091 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005091
Domain Number 1 Region: 43-171
Classification Level Classification E-value
Superfamily TPR-like 1.87e-18
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 
Domain Number 2 Region: 848-887
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000615
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 771-803
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000837
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number 4 Region: 906-934
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000222
Family CCCH zinc finger 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005091
Domain Number - Region: 631-662
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 506-535
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0597
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005091   Gene: ENSTGUG00000004910   Transcript: ENSTGUT00000005141
Sequence length 973
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:6631150:6650754:-1 gene:ENSTGUG00000004910 transcript:ENSTGUT00000005141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSEERSSRQQDIKKGLQFIESTLPYPGTQEQYELFIRDLVRNLFHEGNDVYREGDWR
GSLSHYTEAINIADYANSEEIHVSDDVLEKLHVNRIACFSNMGLHEKVLEDCEIALRLNE
NNFRALYRKAKALNELGSYKKAYDAVAKCSLAVPQDESVIKLTQELAQKLGLKIRKAYVR
AKPPSSNSVCSDASTQVRFYMFQVQADYLSDQKQEMVSAASSSNFVSEVSKVSPVPVPPL
PTVMPLQMEKVPLPSTVLANGGNVSFSMPEACLDCGDGDIIIGEELDELLDSVPDPDETV
MQTTGARGPIPAGSVAPSVPFSASLLGTLPVTAGFVPSASLSEIFSQPLASSLENFCSPL
STFSISDPKRDISSSASRDGTPTLNSSNSPLFINGPSALFGSENYMGIAGQTRNDFPNVF
SSTTANIPVSPALAGRNPLEGTHELRQACQLCFVKKGPKLLDYAYHPNLEHKCKKDILIG
RIKNSEDKSWKKIRPRPTKTQYVGPYHICKDVAAEEECRYPGHCTFAYCQEEIDVWTLER
KGAFSREALFGGPGKISLTVSQLLQEYHGLFMFLCEKCFDHKPRIISKRNKDNSSSCSHP
AMHDFEDNKCLVHILRETMVKYSKIRPYQVRCQLDLCRHEVHYGCLREDKCFYAHSLVEL
KVWIMQKESGISHDTIVQESKKYWQNMEASAHGSQILGNQMKYGSLNLKMKFVCGQCWRN
GQVSEPDRNKKYCSAKARHPWSKDRRVVLVMSNERKKWMTIRPLPAKKQVPLQFDLCNHI
ASGKKCQYDGNCSFAHSPEEREMWTYMKENSIQDLEQLYDIWLKTQKPEKGDDAAAQANR
ENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQNCWQYR
FPTGYFSICDRYMAGTCTEGNNCKFAHGNAELREWEERRQVLRMKLSKARKDHLIAPSDN
DFGKYSFLFKDLN
Download sequence
Identical sequences H0Z3E7
ENSTGUP00000005091 59729.ENSTGUP00000005091 ENSTGUP00000005091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]