SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005639 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005639
Domain Number 1 Region: 698-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 782-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000852
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 369-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000739
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 535-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000919
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 457-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000858
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 625-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000052
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 7 Region: 743-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000565
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 827-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000392
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000005639
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.0017
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 428-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00617
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 195-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.019
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005639   Gene: ENSTGUG00000005437   Transcript: ENSTGUT00000005697
Sequence length 1140
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:3493219:3522591:-1 gene:ENSTGUG00000005437 transcript:ENSTGUT00000005697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGSEEIMFIWCEDCGQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGT
EGVFALTQLVKRTQFGPFECKRVLKLEKESVFPLKVFQKEGPLVYFDTTNEDDCNWMMMV
RPATEYEHQNLTAFQHDNDIYFTTCQDIPPGTELRVWYAAFYAKKMEKPVLKQVTSVANV
NTPEGSGTAEGKPNLWTCKVCSSAFQEPQLLTEHLLSHLEQAKGASPSRQNDAEKAEKAA
EAVPADQPVASDAASASTDSRRKARRGRKAKTAKVETPLVIDEEKDSTVERVADAVTEVP
PEEVALPPAPEEKIMDLVLGKMPSTTNSISSVTKFAHHQNTMSLKRSLILSSRHGIRRKL
IKQLGEHKRVYQCSICSKIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVSYK
HSRNEVDSEYRYKCTTCEKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKK
HGDKKFACEICNKMFYRKDVMLDHQRRHLEGVRRVKREDFEHSTESMVRYKKEPSGCPVC
GKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFI
GKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMDVHKEKGYGCSICNR
RFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACE
QCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKECHR
KFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVT
DYMLQKHIQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEILSVRIDDLEPLPETTT
IDASSIGIVQPELALEQGELPEGKQHIKTPKRGQKRKQKSGEEEEAQVPEDPAFSEYTEK
EGEFTGNVGDETNSAVQSIQQVVVTLSDPNVTAPSSSVGLTNITVTPITTAAGTQFTNLQ
PVAVGQLGTPERQLQLDNSILTVTFDTVSGSAVLHNRQSDIQLPPQPEAPNPQSVAHFIN
LTTLVNSIAPLGNQMSEQHPLSWRSVPQTDVLQPPAPATPQQPGQQPVQTEQQQQQMYSY
Download sequence
Identical sequences H0Z4Z4
ENSTGUP00000005639 59729.ENSTGUP00000005639 ENSTGUP00000005639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]